Lineage for d4f4ob_ (4f4o B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474002Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1474579Species Pig (Sus scrofa) [TaxId:9823] [46507] (3 PDB entries)
  8. 1474584Domain d4f4ob_: 4f4o B: [234409]
    Other proteins in same PDB: d4f4oa_, d4f4od_, d4f4og_, d4f4oj_
    automated match to d1qpwb_
    complexed with hem, nag, oxy

Details for d4f4ob_

PDB Entry: 4f4o (more details), 2.9 Å

PDB Description: structure of the haptoglobin-haemoglobin complex
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d4f4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f4ob_ a.1.1.2 (B:) Hemoglobin, beta-chain {Pig (Sus scrofa) [TaxId: 9823]}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpnvqaafqkvvagvanalahkyh

SCOPe Domain Coordinates for d4f4ob_:

Click to download the PDB-style file with coordinates for d4f4ob_.
(The format of our PDB-style files is described here.)

Timeline for d4f4ob_: