Lineage for d4f4ea_ (4f4e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896854Species Burkholderia pseudomallei [TaxId:272560] [226390] (1 PDB entry)
  8. 2896855Domain d4f4ea_: 4f4e A: [221022]
    automated match to d1yaaa_
    complexed with edo

Details for d4f4ea_

PDB Entry: 4f4e (more details), 1.8 Å

PDB Description: crystal structure of aromatic-amino-acid aminotransferase from burkholderia pseudomallei covalently bound to pyridoxal phosphate
PDB Compounds: (A:) Aromatic-amino-acid aminotransferase

SCOPe Domain Sequences for d4f4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f4ea_ c.67.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
mslfsavelaprdpilglneafnadtrptkvnlgvgvytnedgkipllravrdaekarve
aglprgylpidgiaaydasvqklllgddspliaagrvvtaqalggtgalkigadflrtln
pkakvaisdpswenhralfdmagfevvaypyydaktngvnfdgmlaalngyepgtivvlh
acchnptgvdlndaqwaqvvevvkarrlvpfldiayqgfgesieadaaavrlfaaanlnv
fvsssfsksfslygervgalsiitdskdeaarvlsqlkrvirtnysnppthggaivaavl
aspelraswvqelgemrdriramrnglverlkaagierdfsfinaqrgmfsysgltsaqv
drlreefgiyavstgricvaalntrnldvvanaiaavlk

SCOPe Domain Coordinates for d4f4ea_:

Click to download the PDB-style file with coordinates for d4f4ea_.
(The format of our PDB-style files is described here.)

Timeline for d4f4ea_: