Lineage for d4f38a_ (4f38 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the restProtein automated matches [190047] (27 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186896] (12 PDB entries) 
Domain d4f38a_: 4f38 A: [195316]
Other proteins in same PDB: d4f38b_
automated match to d1cc0a_
complexed with ger, gnp, mg
Details for d4f38a_
PDB Entry: 4f38 (more details), 2.8 Å
PDB Description: Crystal structure of geranylgeranylated RhoA in complex with RhoGDI in its active GPPNHP-bound form
PDB Compounds: (A:) transforming protein rhoaSCOPe Domain Sequences for d4f38a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f38a_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
arrgkkksgc
SCOPe Domain Coordinates for d4f38a_:
Click to download the PDB-style file with coordinates for d4f38a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4f38a_:
- d4f38a_ first appeared in SCOPe 2.02
- d4f38a_ appears in SCOPe 2.04
- d4f38a_ appears in SCOPe 2.06
- d4f38a_ appears in the current release, SCOPe 2.08
View in 3D
