Lineage for d4ey2a_ (4ey2 A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) 
Family d.157.1.0: automated matches [191360] (1 protein)
not a true familyProtein automated matches [190418] (12 species)
not a true proteinSpecies Klebsiella pneumoniae [TaxId:573] [189718] (28 PDB entries) 
Domain d4ey2a_: 4ey2 A: [234407]
automated match to d3q6xb_
complexed with 0rm, zn
Details for d4ey2a_
PDB Entry: 4ey2 (more details), 1.17 Å
PDB Description: crystal structure of ndm-1 bound to hydrolyzed methicillin
PDB Compounds: (A:) Beta-lactamase NDM-1SCOPe Domain Sequences for d4ey2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ey2a_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r
SCOPe Domain Coordinates for d4ey2a_:
Click to download the PDB-style file with coordinates for d4ey2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ey2a_:
- d4ey2a_ first appeared in SCOPe 2.03
- d4ey2a_ appears in SCOPe 2.05
- d4ey2a_ appears in the current release, SCOPe 2.08
View in 3D
