Lineage for d4ewja1 (4ewj A:1-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948593Species Streptococcus suis [TaxId:1307] [226501] (1 PDB entry)
  8. 2948594Domain d4ewja1: 4ewj A:1-137 [220893]
    Other proteins in same PDB: d4ewja2, d4ewjb2
    automated match to d1w6ta2

Details for d4ewja1

PDB Entry: 4ewj (more details), 2.4 Å

PDB Description: structure of the enloase from Streptococcus suis serotype 2
PDB Compounds: (A:) Enolase 2

SCOPe Domain Sequences for d4ewja1:

Sequence, based on SEQRES records: (download)

>d4ewja1 d.54.1.0 (A:1-137) automated matches {Streptococcus suis [TaxId: 1307]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
glgtqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavar
aaadylevplytylggf

Sequence, based on observed residues (ATOM records): (download)

>d4ewja1 d.54.1.0 (A:1-137) automated matches {Streptococcus suis [TaxId: 1307]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrylglg
tqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavaraaa
dylevplytylggf

SCOPe Domain Coordinates for d4ewja1:

Click to download the PDB-style file with coordinates for d4ewja1.
(The format of our PDB-style files is described here.)

Timeline for d4ewja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ewja2