Lineage for d4ewha_ (4ewh A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species)
PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [111201] (8 PDB entries)
Uniprot Q07912 117-389
Domain d4ewha_: 4ewh A: [193519]
automated match to d3eqra_
complexed with t77
Details for d4ewha_
PDB Entry: 4ewh (more details), 2.5 Å
PDB Description: Co-crystal structure of ACK1 with inhibitor
PDB Compounds: (A:) Activated CDC42 kinase 1SCOPe Domain Sequences for d4ewha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ewha_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
pqdiynvmvqcwahkpedrptfvalrdflleaqpt
SCOPe Domain Coordinates for d4ewha_:
Click to download the PDB-style file with coordinates for d4ewha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ewha_:
- d4ewha_ first appeared in SCOPe 2.02
- d4ewha_ appears in SCOPe 2.05
- d4ewha_ appears in SCOPe 2.07
- d4ewha_ appears in the current release, SCOPe 2.08
View in 3D
