Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [190161] (29 species) not a true protein |
Species Serratia fonticola [TaxId:47917] [195324] (4 PDB entries) |
Domain d4ev4a_: 4ev4 A: [195325] automated match to d1dy6a_ complexed with edo, mer; mutant |
PDB Entry: 4ev4 (more details), 1.3 Å
SCOPe Domain Sequences for d4ev4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ev4a_ e.3.1.1 (A:) automated matches {Serratia fonticola [TaxId: 47917]} asqppqvtvdklkrlendfggrigvyaidtgsnktfgyranerfplcssfkgflaaavls ksqqqegllnqrirydnrvmephspvtekqittgmtvaelsaatlqysdngaanlllekl iggpegmtsfmrsigdnvfrldrwalelnsaipgddrdtstpkavaesmqklafgnvlgl terhqlmdwfkgnttggarirasvpanwvvgdktgtcgvygtandyaviwpvahapivla vytskpdrnskhsdaviadasrivlesfni
Timeline for d4ev4a_: