Lineage for d4ev4a_ (4ev4 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013936Species Serratia fonticola [TaxId:47917] [195324] (4 PDB entries)
  8. 3013938Domain d4ev4a_: 4ev4 A: [195325]
    automated match to d1dy6a_
    complexed with edo, mer; mutant

Details for d4ev4a_

PDB Entry: 4ev4 (more details), 1.3 Å

PDB Description: Crystal structure of serratia fonticola carbapenemase SFC-1 E166A mutant with the acylenzyme intermediate of meropenem
PDB Compounds: (A:) Carbapenem-hydrolizing beta-lactamase SFC-1

SCOPe Domain Sequences for d4ev4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ev4a_ e.3.1.1 (A:) automated matches {Serratia fonticola [TaxId: 47917]}
asqppqvtvdklkrlendfggrigvyaidtgsnktfgyranerfplcssfkgflaaavls
ksqqqegllnqrirydnrvmephspvtekqittgmtvaelsaatlqysdngaanlllekl
iggpegmtsfmrsigdnvfrldrwalelnsaipgddrdtstpkavaesmqklafgnvlgl
terhqlmdwfkgnttggarirasvpanwvvgdktgtcgvygtandyaviwpvahapivla
vytskpdrnskhsdaviadasrivlesfni

SCOPe Domain Coordinates for d4ev4a_:

Click to download the PDB-style file with coordinates for d4ev4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ev4a_: