Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267930] (1 PDB entry) |
Domain d4euka_: 4euk A: [262702] Other proteins in same PDB: d4eukb_ automated match to d1dcfa_ complexed with edo, mg |
PDB Entry: 4euk (more details), 1.95 Å
SCOPe Domain Sequences for d4euka_:
Sequence, based on SEQRES records: (download)
>d4euka_ c.23.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} skpkillvednkinimvaksmmkqlghtmdianngveaitainsssydlvlmdvcmpvld glkatrlirsyeetgnwnaaieagvdistseneqvcmrptnrlpiiamtantlaesseec yangmdsfiskpvtlqklreclqqylh
>d4euka_ c.23.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} skpkillvednkinimvaksmmkqlghtmdianngveaitainsssydlvlmdvcmpvld glkatrlirsyeetgnwnaaieagvdistnrlpiiamtantlaesseecyangmdsfisk pvtlqklreclqqylh
Timeline for d4euka_: