Lineage for d4eu3a2 (4eu3 A:230-505)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922594Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2922595Protein automated matches [191112] (17 species)
    not a true protein
  7. 2922600Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries)
  8. 2922610Domain d4eu3a2: 4eu3 A:230-505 [220809]
    Other proteins in same PDB: d4eu3a3
    automated match to d2g39a2
    complexed with cit, cl

Details for d4eu3a2

PDB Entry: 4eu3 (more details), 1.58 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6) in complex with citrate (subunit b) or unliganded (subunit a)
PDB Compounds: (A:) Succinyl-CoA:acetate coenzyme A transferase

SCOPe Domain Sequences for d4eu3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eu3a2 c.124.1.0 (A:230-505) automated matches {Acetobacter aceti [TaxId: 435]}
apfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenl
vgyseviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnsp
giirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakg
gkisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdy
fdralknsfgkhtphlltealswhqrfidtgtmlps

SCOPe Domain Coordinates for d4eu3a2:

Click to download the PDB-style file with coordinates for d4eu3a2.
(The format of our PDB-style files is described here.)

Timeline for d4eu3a2: