Lineage for d4eu1a_ (4eu1 A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.0: automated matches [191328] (1 protein)
not a true familyProtein automated matches [190151] (160 species)
not a true protein
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226378] (1 PDB entry) 
Domain d4eu1a_: 4eu1 A: [220806]
automated match to d7aata_
complexed with cl, edo
Details for d4eu1a_
PDB Entry: 4eu1 (more details), 2.3 Å
PDB Description: structure of a mitochondrial aspartate aminotransferase from trypanosoma brucei
PDB Compounds: (A:) Mitochondrial aspartate aminotransferaseSCOPe Domain Sequences for d4eu1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eu1a_ c.67.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
pilglgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnmdyapvtgiasfve
eaqklcfgptcaalrdgriascqtlggtgalriggdllnrfvancnriygpdvgypnhes
ifakagmeltpysyydpatkglnlagmlecldkapegsvilvhacahnptgvdpthddwr
qvcdvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnlivaqsfsknfglyghr
cgalhistasaeeakrlvsqlallirpmynnpplygawvvssilkdpqltalwkkelkqm
ssriaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvellrseyhiymtlngr
aavsglnstnveyvsqaihnvtk
SCOPe Domain Coordinates for d4eu1a_:
Click to download the PDB-style file with coordinates for d4eu1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4eu1a_:
- d4eu1a_ first appeared in SCOPe 2.03
- d4eu1a_ appears in SCOPe 2.06
- d4eu1a_ appears in the current release, SCOPe 2.08
View in 3D
