![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (98 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226378] (1 PDB entry) |
![]() | Domain d4eu1a_: 4eu1 A: [220806] automated match to d7aata_ complexed with cl, edo |
PDB Entry: 4eu1 (more details), 2.3 Å
SCOPe Domain Sequences for d4eu1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eu1a_ c.67.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} pilglgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnmdyapvtgiasfve eaqklcfgptcaalrdgriascqtlggtgalriggdllnrfvancnriygpdvgypnhes ifakagmeltpysyydpatkglnlagmlecldkapegsvilvhacahnptgvdpthddwr qvcdvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnlivaqsfsknfglyghr cgalhistasaeeakrlvsqlallirpmynnpplygawvvssilkdpqltalwkkelkqm ssriaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvellrseyhiymtlngr aavsglnstnveyvsqaihnvtk
Timeline for d4eu1a_: