Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) share the common active site structure with the family II |
Family c.44.1.0: automated matches [191415] (1 protein) not a true family |
Protein automated matches [190574] (20 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [193436] (3 PDB entries) |
Domain d4etma1: 4etm A:-3-156 [201957] Other proteins in same PDB: d4etma2, d4etmb2 automated match to d4etmb_ complexed with k, na, po4 |
PDB Entry: 4etm (more details), 1.6 Å
SCOPe Domain Sequences for d4etma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4etma1 c.44.1.0 (A:-3-156) automated matches {Bacillus subtilis [TaxId: 1423]} grgsmisvlfvclgnicrspmaeaifrdlaakkglegkikadsagiggwhignpphegtq eilrregisfdgmlarqvseqdlddfdyiiamdaenigslrsmagfkntshikrlldyve dsdladvpdpyytgnfeevcqliktgceqllasiqkekql
Timeline for d4etma1: