Lineage for d4esra_ (4esr A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helixSuperfamily b.34.2: SH3-domain [50044] (2 families) 
Family b.34.2.0: automated matches [191375] (1 protein)
not a true familyProtein automated matches [190457] (10 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries) 
Domain d4esra_: 4esr A: [220791]
automated match to d1k4us_
complexed with peg
Details for d4esra_
PDB Entry: 4esr (more details), 1.53 Å
PDB Description: molecular and structural characterization of the sh3 domain of ahi-1 in regulation of cellular resistance of bcr-abl+ chronic myeloid leukemia cells to tyrosine kinase inhibitors
PDB Compounds: (A:) JouberinSCOPe Domain Sequences for d4esra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4esra_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
taptvvalydytanrsdeltihrgdiirvffkdnedwwygsigkgqegyfpanhvasetl
yqelp
SCOPe Domain Coordinates for d4esra_:
Click to download the PDB-style file with coordinates for d4esra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4esra_:
- d4esra_ first appeared in SCOPe 2.03
- d4esra_ appears in SCOPe 2.05
- d4esra_ appears in SCOPe 2.07
- d4esra_ appears in the current release, SCOPe 2.08
View in 3D
