Lineage for d4espa_ (4esp A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576611Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2576612Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2576654Protein automated matches [190412] (11 species)
    not a true protein
  7. 2576689Species Peanut (Arachis hypogaea) [TaxId:3818] [193926] (1 PDB entry)
  8. 2576690Domain d4espa_: 4esp A: [193927]
    automated match to d1g5ua_
    complexed with edo, ipa

Details for d4espa_

PDB Entry: 4esp (more details), 1.1 Å

PDB Description: crystal structure of peanut allergen ara h 5
PDB Compounds: (A:) Profilin

SCOPe Domain Sequences for d4espa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4espa_ d.110.1.1 (A:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
swqtyvddhllceiegnhlssaailgqdgsvwaqssnfpqfkpeeitaimndfaepgsla
ptglylggtkymviqgepgtvirgkkgpggvtikktnqaliigiydepmtpgqcnmivek
lgdylidtgl

SCOPe Domain Coordinates for d4espa_:

Click to download the PDB-style file with coordinates for d4espa_.
(The format of our PDB-style files is described here.)

Timeline for d4espa_: