Lineage for d4esad_ (4esa D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717951Species Eleginops maclovinus [TaxId:56733] [193401] (1 PDB entry)
  8. 1717955Domain d4esad_: 4esa D: [193402]
    automated match to d2h8fb_
    complexed with cmo, gol, hem

Details for d4esad_

PDB Entry: 4esa (more details), 1.45 Å

PDB Description: x-ray structure of carbonmonoxy hemoglobin of eleginops maclovinus
PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d4esad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4esad_ a.1.1.2 (D:) automated matches {Eleginops maclovinus [TaxId: 56733]}
vewtdqeratissifgsldyddigpkalsrclivypwtqrhfgsfgnlynaeaiignqkv
aahgikvlhgldravknmdnikeiyaelsilhseklhvdpdnfklladcltivvaakmgs
gfnpgtqatfqkflavvvsalgkqy

SCOPe Domain Coordinates for d4esad_:

Click to download the PDB-style file with coordinates for d4esad_.
(The format of our PDB-style files is described here.)

Timeline for d4esad_: