Lineage for d4erib_ (4eri B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
Pfam PF04909; Amidohydrolase; stand-alone domain
Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species) Species Pseudomonas fluorescens [TaxId:294] [141825] (14 PDB entries)
Uniprot Q83V25 3-333
Domain d4erib_: 4eri B: [193578]
automated match to d2hbxa_
complexed with mg, zn
Details for d4erib_
PDB Entry: 4eri (more details), 2 Å
PDB Description: evidence for a dual role of an active site histidine in alpha-amino- beta-carboxymuconate-epsilon-semialdehyde decarboxylase
PDB Compounds: (B:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylaseSCOPe Domain Sequences for d4erib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4erib_ c.1.9.15 (B:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]}
pridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpafr
ieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvpl
qdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmmg
gqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrvdna
wrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeqk
igglvlssnlgesakdkiisgnaskffnin
SCOPe Domain Coordinates for d4erib_:
Click to download the PDB-style file with coordinates for d4erib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4erib_:
- d4erib_ first appeared in SCOPe 2.02
- d4erib_ appears in SCOPe 2.07
View in 3D
