Lineage for d4ereb_ (4ere B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
duplication: consists of two structural repeatsSuperfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) 
binds to the transactivation domain of human p53
Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
Pfam PF02201Protein MDM2 [47594] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries) 
Domain d4ereb_: 4ere B: [192402]
automated match to d1t4ea_
complexed with 0r2, so4
Details for d4ereb_
PDB Entry: 4ere (more details), 1.8 Å
PDB Description: crystal structure of MDM2 (17-111) in complex with compound 23
PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2SCOPe Domain Sequences for d4ereb_:
Sequence, based on SEQRES records: (download)
>d4ereb_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
csndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
Sequence, based on observed residues (ATOM records): (download)
>d4ereb_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyhivycsndl
lgdlfgvpsfsvkehrkiytmiyrnlvvvn
SCOPe Domain Coordinates for d4ereb_:
Click to download the PDB-style file with coordinates for d4ereb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ereb_:
- d4ereb_ first appeared in SCOPe 2.02
- d4ereb_ appears in SCOPe 2.04
- d4ereb_ appears in SCOPe 2.06
- d4ereb_ appears in the current release, SCOPe 2.08
View in 3D
