Lineage for d4eqyg_ (4eqy G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814237Species Burkholderia thailandensis [TaxId:271848] [226377] (1 PDB entry)
  8. 2814243Domain d4eqyg_: 4eqy G: [220779]
    automated match to d2qiaa_

Details for d4eqyg_

PDB Entry: 4eqy (more details), 1.8 Å

PDB Description: Crystal structure of Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase from Burkholderia thailandensis
PDB Compounds: (G:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d4eqyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eqyg_ b.81.1.0 (G:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
rihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighya
svggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhighd
crvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfvi
aagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggdg
daavkalvdfvessqrgiir

SCOPe Domain Coordinates for d4eqyg_:

Click to download the PDB-style file with coordinates for d4eqyg_.
(The format of our PDB-style files is described here.)

Timeline for d4eqyg_: