Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) |
Family c.23.2.0: automated matches [196997] (1 protein) not a true family |
Protein automated matches [196998] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196999] (5 PDB entries) |
Domain d4eo7a_: 4eo7 A: [197002] automated match to d1fywa_ complexed with mg |
PDB Entry: 4eo7 (more details), 1.45 Å
SCOPe Domain Sequences for d4eo7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eo7a_ c.23.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ggvdmperfdaficycpsdiqfvqemirqleqtnyrlklcvsdrdvlpgtcvwsiaseli ekrcrrmvvvvsddylqskecdfqtkfalslspgahqkrlipikykamkkefpsilrfit vcdytnpctkswfwtrlakalslp
Timeline for d4eo7a_: