Lineage for d4em8b_ (4em8 B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase foldSuperfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) 
Family c.121.1.0: automated matches [191649] (1 protein)
not a true familyProtein automated matches [191196] (7 species)
not a true protein
Species Anaplasma phagocytophilum [TaxId:212042] [195541] (1 PDB entry) 
Domain d4em8b_: 4em8 B: [195542]
automated match to d1o1xa_
Details for d4em8b_
PDB Entry: 4em8 (more details), 1.95 Å
PDB Description: The Structure of Ribose 5-phosphate Isomerase B from Anaplasma phagocytophilum
PDB Compounds: (B:) Ribose 5-phosphate isomerase BSCOPe Domain Sequences for d4em8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4em8b_ c.121.1.0 (B:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
gsmvvkrvflssdhagvelrlflsaylrdlgcevfdcgcdpkehsvdypdyvhdvvrevs
dtsfgvlicgtgigmsiaanrhkniraalcsstmlaklsrehndanvlcfgsryidpdta
qsvlytfmttaflggrhavrvqklg
SCOPe Domain Coordinates for d4em8b_:
Click to download the PDB-style file with coordinates for d4em8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4em8b_:
- d4em8b_ first appeared in SCOPe 2.02
- d4em8b_ appears in SCOPe 2.04
- d4em8b_ is called d4em8b1 in SCOPe 2.06
- d4em8b_ appears in the current release, SCOPe 2.08, called d4em8b1
View in 3D
