Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (19 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries) |
Domain d4elha_: 4elh A: [192627] automated match to d3fl8a_ complexed with 53i, 53j, ca, cl |
PDB Entry: 4elh (more details), 2.1 Å
SCOPe Domain Sequences for d4elha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4elha_ c.71.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr
Timeline for d4elha_: