SCOPe 2.07: Domain d4egqb1: 4egq B:5-102

Lineage for d4egqb1 (4egq B:5-102)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
possible rudiment form of Rossmann-fold domain
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
Family c.30.1.0: automated matches [227183] (1 protein)
not a true family
Protein automated matches [226903] (39 species)
not a true protein
Species Burkholderia pseudomallei [TaxId:320372] [226351] (3 PDB entries)
Domain d4egqb1: 4egq B:5-102 [220528]
Other proteins in same PDB: d4egqa2, d4egqb2, d4egqc2, d4egqd2
automated match to d1e4ea1

Details for d4egqb1

PDB Entry: 4egq (more details), 2.2 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase b from burkholderia pseudomallei

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egqb1 c.30.1.0 (B:5-102) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdegfvr
afnalhggygengqiqgaldfygirytgsgvlgsalgl

SCOPe Domain Coordinates for d4egqb1:

Click to download the PDB-style file with coordinates for d4egqb1.
(The format of our PDB-style files is described here.)

Timeline for d4egqb1: