![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
![]() | Protein automated matches [190459] (36 species) not a true protein |
![]() | Species Trypanosoma brucei [TaxId:999953] [226467] (6 PDB entries) |
![]() | Domain d4eg3b1: 4eg3 B:237-606 [220488] Other proteins in same PDB: d4eg3b2 automated match to d1rqga2 protein/RNA complex; complexed with gol, me8 |
PDB Entry: 4eg3 (more details), 2.94 Å
SCOPe Domain Sequences for d4eg3b1:
Sequence, based on SEQRES records: (download)
>d4eg3b1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]} kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl gryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerl lewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwld altnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsagl plpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdk nmiarlngel
>d4eg3b1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]} kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl gryegwysisdesfltpqnitdgvdckvslesghvvtwvseenymfrlsafrerllewyh anpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltny ltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpkk ivahgwwtkdrkkisknvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlng el
Timeline for d4eg3b1: