Lineage for d4efea_ (4efe A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928907Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 1928923Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
    automatically mapped to Pfam PF01653
  6. 1928950Protein automated matches [194553] (3 species)
    not a true protein
  7. 1928951Species Enterococcus faecalis [TaxId:1351] [196940] (1 PDB entry)
  8. 1928952Domain d4efea_: 4efe A: [196941]
    automated match to d1taea_
    protein/DNA complex; complexed with 0ov, nmn, so4

Details for d4efea_

PDB Entry: 4efe (more details), 2 Å

PDB Description: crystal structure of dna ligase
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d4efea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4efea_ d.142.2.2 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
pltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpds
ptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidgl
aislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsfv
alneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfeal
eelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgft
vkaprwaiaykfp

SCOPe Domain Coordinates for d4efea_:

Click to download the PDB-style file with coordinates for d4efea_.
(The format of our PDB-style files is described here.)

Timeline for d4efea_: