Lineage for d4eetb_ (4eet B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alphaSuperfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) 
alpha-beta(2)-alpha(2)-beta(3)
Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
contains PAC motifProtein automated matches [190943] (2 species)
not a true proteinSpecies Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (20 PDB entries) 
Domain d4eetb_: 4eet B: [220461]
automated match to d4eesa_
complexed with fmn
Details for d4eetb_
PDB Entry: 4eet (more details), 1.2 Å
PDB Description: Crystal structure of iLOV
PDB Compounds: (B:) Phototropin-2SCOPe Domain Sequences for d4eetb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eetb_ d.110.3.6 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fieknfvitdprlpdnpiifasdgflelteysreeilgrnarflqgpetdqatvqkirda
irdqrettvqlinytksgkkfwnllhlqpvrdqkgelqyfigvqldgsdhv
SCOPe Domain Coordinates for d4eetb_:
Click to download the PDB-style file with coordinates for d4eetb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4eetb_:
- d4eetb_ first appeared in SCOPe 2.03
- d4eetb_ appears in SCOPe 2.07
View in 3D
