Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins) contains PAC motif |
Protein automated matches [190943] (2 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (20 PDB entries) |
Domain d4eetb_: 4eet B: [220461] automated match to d4eesa_ complexed with fmn |
PDB Entry: 4eet (more details), 1.2 Å
SCOPe Domain Sequences for d4eetb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eetb_ d.110.3.6 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} fieknfvitdprlpdnpiifasdgflelteysreeilgrnarflqgpetdqatvqkirda irdqrettvqlinytksgkkfwnllhlqpvrdqkgelqyfigvqldgsdhv
Timeline for d4eetb_: