Lineage for d4ecpb_ (4ecp B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) 
Family b.40.5.0: automated matches [191399] (1 protein)
not a true familyProtein automated matches [190523] (11 species)
not a true protein
Species Mycobacterium leprae [TaxId:1769] [195580] (1 PDB entry) 
Domain d4ecpb_: 4ecp B: [195581]
automated match to d1udea_
complexed with edo
Details for d4ecpb_
PDB Entry: 4ecp (more details), 1.8 Å
PDB Description: x-ray crystal structure of inorganic pyrophosphate ppa from mycobacterium leprae
PDB Compounds: (B:) inorganic pyrophosphataseSCOPe Domain Sequences for d4ecpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ecpb_ b.40.5.0 (B:) automated matches {Mycobacterium leprae [TaxId: 1769]}
mvqfdvtieipkgqrnkyevdhktgrvrldrylytpmayptdygfiedtlgedgdpldal
vllpeplfpgvlvearpvgmfrmvdehggddkvlcvpvndhrwdhihgiidvptfeldai
khffvhykdlepgkfvkaadwvgrdeaeaevqrsverfkagg
SCOPe Domain Coordinates for d4ecpb_:
Click to download the PDB-style file with coordinates for d4ecpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ecpb_:
- d4ecpb_ first appeared in SCOPe 2.02
- d4ecpb_ appears in SCOPe 2.04
- d4ecpb_ is called d4ecpb1 in SCOPe 2.06
- d4ecpb_ appears in the current release, SCOPe 2.08, called d4ecpb1
View in 3D
