Lineage for d4eatb_ (4eat B:)
- Root: SCOPe 2.05
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) 
Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+betaSuperfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) 
Family e.23.1.0: automated matches [191594] (1 protein)
not a true familyProtein automated matches [191083] (15 species)
not a true protein
Species Rhodopseudomonas palustris [TaxId:1076] [189027] (8 PDB entries) 
Domain d4eatb_: 4eat B: [234368]
automated match to d2v7ba_
complexed with bez, edo, gol
Details for d4eatb_
PDB Entry: 4eat (more details), 1.8 Å
PDB Description: crystal structure of a benzoate coenzyme a ligase
PDB Compounds: (B:) benzoate-coenzyme a ligaseSCOPe Domain Sequences for d4eatb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eatb_ e.23.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
vtpppekfnfaehllqtnrvrpdktafvddisslsfaqleaqtrqlaaalraigvkreer
vlllmldgtdwpvaflgaiyagivpvavntlltaddyaymlehsraqavlvsgalhpvlk
aaltksdhevqrvivsrpaaplepgevdfaefvgahaplekpaatqaddpafwlyssgst
grpkgvvhthanpywtselygrntlhlreddvcfsaaklffayglgnaltfpmtvgattl
lmgerptpdavfkrwlggvggvkptvfygaptgyagmlaapnlpsrdqvalrlassagea
lpaeigqrfqrhfgldivdgigstemlhiflsnlpdrvrygttgwpvpgyqielrgdggg
pvadgepgdlyihgpssatmywgnraksrdtfqggwtksgdkyvrnddgsytyagrtddm
lkvsgiyvspfeieatlvqhpgvleaavvgvadehgltkpkayvvprpgqtlsetelktf
ikdrlapykyprstvfvaelpktatgkiqrfklregvlg
SCOPe Domain Coordinates for d4eatb_:
Click to download the PDB-style file with coordinates for d4eatb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4eatb_:
- d4eatb_ first appeared in SCOPe 2.03
- d4eatb_ appears in SCOPe 2.04
- d4eatb_ is called d4eatb1 in SCOPe 2.06
- d4eatb_ appears in the current release, SCOPe 2.08, called d4eatb1
View in 3D
