Lineage for d4e8ba2 (4e8b A:74-243)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921365Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain
  6. 2921386Protein automated matches [227088] (1 species)
    not a true protein
  7. 2921387Species Escherichia coli K-12 [TaxId:83333] [226466] (1 PDB entry)
  8. 2921388Domain d4e8ba2: 4e8b A:74-243 [220359]
    Other proteins in same PDB: d4e8ba1, d4e8ba3
    automated match to d1vhya2

Details for d4e8ba2

PDB Entry: 4e8b (more details), 2.25 Å

PDB Description: crystal structure of 16s rrna methyltransferase rsme from e.coli
PDB Compounds: (A:) Ribosomal RNA small subunit methyltransferase E

SCOPe Domain Sequences for d4e8ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e8ba2 c.116.1.5 (A:74-243) automated matches {Escherichia coli K-12 [TaxId: 83333]}
resplhihlgqvmsrgekmeftiqksielgvslitplfsercgvkldserlnkklqqwqk
iaiaaceqcgrnrvpeirpamdleawcaeqdeglklnlhprasnsintlplpvervrlli
gpegglsadeiamtaryqftdillgprvlrtettaltaitalqvrfgdlg

SCOPe Domain Coordinates for d4e8ba2:

Click to download the PDB-style file with coordinates for d4e8ba2.
(The format of our PDB-style files is described here.)

Timeline for d4e8ba2: