Lineage for d4e6pb_ (4e6p B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1828143Protein automated matches [190085] (47 species)
    not a true protein
  7. 1828502Species Sinorhizobium meliloti [TaxId:266834] [195628] (1 PDB entry)
  8. 1828504Domain d4e6pb_: 4e6p B: [195629]
    automated match to d1k2wa_
    complexed with edo, na

Details for d4e6pb_

PDB Entry: 4e6p (more details), 2.1 Å

PDB Description: Crystal structure of a probable sorbitol dehydrogenase (Target PSI-012078) from Sinorhizobium meliloti 1021
PDB Compounds: (B:) Probable sorbitol dehydrogenase (L-iditol 2-dehydrogenase)

SCOPe Domain Sequences for d4e6pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6pb_ c.2.1.2 (B:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
krlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavqmdv
trqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlftlqa
aarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinvnai
apgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasaesd
yivsqtynvdggnwms

SCOPe Domain Coordinates for d4e6pb_:

Click to download the PDB-style file with coordinates for d4e6pb_.
(The format of our PDB-style files is described here.)

Timeline for d4e6pb_: