Lineage for d4e2pa_ (4e2p A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2723142Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2723143Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2724019Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2724020Protein automated matches [190847] (97 species)
    not a true protein
  7. 2724796Species Streptomyces himastatinicus [TaxId:457427] [346182] (5 PDB entries)
  8. 2724799Domain d4e2pa_: 4e2p A: [345230]
    automated match to d5ikia_
    complexed with hem, mg

Details for d4e2pa_

PDB Entry: 4e2p (more details), 2.36 Å

PDB Description: Crystal Structure of a Post-tailoring Hydroxylase (HmtN) Involved in the Himastatin Biosynthesis
PDB Compounds: (A:) Cytochrome P450 107B1 (P450CVIIB1)

SCOPe Domain Sequences for d4e2pa_:

Sequence, based on SEQRES records: (download)

>d4e2pa_ a.104.1.0 (A:) automated matches {Streptomyces himastatinicus [TaxId: 457427]}
mttpaerwgihpehfwlygrrprqmvefdekmnawnvygyaeaievlgdpgtfsshmsrl
lpmgadeaftegdllqtdppdhrelrklvshaftpkvvaelepritaltqelldavadrd
tfdlmtalayplpvtvvaellsipsadrhlfegwmteivhslgdvsmedapedqerifea
gmapmrkmleylrehaaecrrrprgdlmgklieaevdgrrltdnhivnfakmlliagylt
ttmligntvlcldsypeqaarvradrslipglleesmrflspvaatyrattrdvevagqr
lsadqmvmvwfgaanrdarqfaepelfdmtrgpnphlgfgrgihfclggplarmegrval
dhlldrfpelytdperpptfmpgfdttgvsslplrts

Sequence, based on observed residues (ATOM records): (download)

>d4e2pa_ a.104.1.0 (A:) automated matches {Streptomyces himastatinicus [TaxId: 457427]}
mttpaerwgihpehfwlygrrprqmvefdekmnawnvygyaeaievlgdpgtfsshmsrl
lftegdllqtdppdhrelrklvshaftpkvvaelepritaltqelldavadrdtfdlmta
layplpvtvvaellsipsadrhlfegwmteivhsmapmrkmleylrehaaecrrrprgdl
mgklieaevdgrrltdnhivnfakmlliagyltttmligntvlcldsypeqaarvradrs
lipglleesmrflspvaatyrattrdvevagqrlsadqmvmvwfgaanrdarqfaepelf
dmtrgpnphlgfgrgihfclggplarmegrvaldhlldrfpelytdperpptfmpgfdtt
gvsslplrts

SCOPe Domain Coordinates for d4e2pa_:

Click to download the PDB-style file with coordinates for d4e2pa_.
(The format of our PDB-style files is described here.)

Timeline for d4e2pa_: