Lineage for d4e26a_ (4e26 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein automated matches [190091] (12 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries) 
Domain d4e26a_: 4e26 A: [220165]
automated match to d1i44a_
complexed with 734
Details for d4e26a_
PDB Entry: 4e26 (more details), 2.55 Å
PDB Description: BRAF in complex with an organic inhibitor 7898734
PDB Compounds: (A:) Serine/threonine-protein kinase B-rafSCOPe Domain Sequences for d4e26a_:
Sequence, based on SEQRES records: (download)
>d4e26a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
amkrlmaeclkkkrderplfpqilasiellarslpk
Sequence, based on observed residues (ATOM records): (download)
>d4e26a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatvksrfeqlsgsilwmapevirmqdknpy
sfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlm
aeclkkkrderplfpqilasiellarslpk
SCOPe Domain Coordinates for d4e26a_:
Click to download the PDB-style file with coordinates for d4e26a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4e26a_:
- d4e26a_ first appeared in SCOPe 2.03
- d4e26a_ appears in SCOPe 2.04
- d4e26a_ appears in SCOPe 2.06
- d4e26a_ appears in the current release, SCOPe 2.08
View in 3D
