Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (20 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [195790] (1 PDB entry) |
Domain d4e08a_: 4e08 A: [195791] automated match to d3b38a_ complexed with so4 |
PDB Entry: 4e08 (more details), 2 Å
SCOPe Domain Sequences for d4e08a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e08a_ c.23.16.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} msksalvilapgaeemefiiaadvlrragikvtvaglnggeavkcsrdvqilpdtslaqv asdkfdvvvlpgglggsnamgesslvgdllrsqesgggliaaicaaptvlakhgvasgks ltsypsmkpqlvnnysyvddktvvkdgnlitsrgpgtayefalkiaeelagkekvqevak gllvay
Timeline for d4e08a_: