Lineage for d4dwfa_ (4dwf A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) 
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
Pfam PF00240
Protein automated matches [190118] (9 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189560] (79 PDB entries) 
Domain d4dwfa_: 4dwf A: [195743]
automated match to d1wx9a1
complexed with so4
Details for d4dwfa_
PDB Entry: 4dwf (more details), 1.8 Å
PDB Description: crystal structure of a hla-b associated transcript 3 (bat3) from homo sapiens at 1.80 a resolution
PDB Compounds: (A:) HLA-B-associated transcript 3SCOPe Domain Sequences for d4dwfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dwfa_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gepdslevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkk
lqeynvggkvihlverapp
SCOPe Domain Coordinates for d4dwfa_:
Click to download the PDB-style file with coordinates for d4dwfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dwfa_:
- d4dwfa_ first appeared in SCOPe 2.02
- d4dwfa_ appears in SCOPe 2.04
- d4dwfa_ is called d4dwfa1 in SCOPe 2.06
- d4dwfa_ appears in the current release, SCOPe 2.08, called d4dwfa1
View in 3D
