Lineage for d4dwba_ (4dwb A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014755Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2014756Protein automated matches [196409] (37 species)
    not a true protein
  7. 2014950Species Trypanosoma cruzi [TaxId:5693] [196823] (14 PDB entries)
  8. 2014956Domain d4dwba_: 4dwb A: [196824]
    automated match to d2f89f_
    complexed with 0m7, act, ipe, mg, na, so4

Details for d4dwba_

PDB Entry: 4dwb (more details), 2.1 Å

PDB Description: Crystal structure of Trypanosoma cruzi farnesyl diphosphate synthase in complex with [2-(n-pentylamino)ethane-1,1-diyl]bisphosphonic acid and Mg2+
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4dwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dwba_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
k

SCOPe Domain Coordinates for d4dwba_:

Click to download the PDB-style file with coordinates for d4dwba_.
(The format of our PDB-style files is described here.)

Timeline for d4dwba_: