Lineage for d4ds0a_ (4ds0 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782129Species Rotavirus sp. [TaxId:10970] [195633] (3 PDB entries)
  8. 1782132Domain d4ds0a_: 4ds0 A: [195634]
    automated match to d2p3ka_

Details for d4ds0a_

PDB Entry: 4ds0 (more details), 1.56 Å

PDB Description: cell attachment protein vp8* of a human rotavirus specifically interacts with a-type histo-blood group antigen
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d4ds0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ds0a_ b.29.1.0 (A:) automated matches {Rotavirus sp. [TaxId: 10970]}
gstldgpyqpttfnlpidywmliaptqigrvaegtnttdrwfacvlvepnvqntqreyvl
dgqtvqlqvsnnsstlwkfilfiklekngaysqystlstsnklcawmkregrvywyagtt
pnasesyyltinndnsnvscdaefyliprsqtelctqyinngl

SCOPe Domain Coordinates for d4ds0a_:

Click to download the PDB-style file with coordinates for d4ds0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ds0a_: