Lineage for d4drja_ (4drj A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2185706Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2185807Protein FKBP52, N-terminal domains [82619] (1 species)
  7. 2185808Species Human (Homo sapiens) [TaxId:9606] [82620] (10 PDB entries)
    Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains
  8. 2185809Domain d4drja_: 4drj A: [193739]
    Other proteins in same PDB: d4drjb1, d4drjb2
    automated match to d1n1aa_
    complexed with rap, so4

Details for d4drja_

PDB Entry: 4drj (more details), 1.8 Å

PDB Description: o-crystal structure of the PPIase domain of FKBP52, Rapamycin and the FRB fragment of mTOR
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP4

SCOPe Domain Sequences for d4drja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4drja_ d.26.1.1 (A:) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
pmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfs
fdlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefk
g

SCOPe Domain Coordinates for d4drja_:

Click to download the PDB-style file with coordinates for d4drja_.
(The format of our PDB-style files is described here.)

Timeline for d4drja_: