Lineage for d4dqcb_ (4dqc B:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrelProtein Human immunodeficiency virus type 1 protease [50632] (8 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (421 PDB entries)
Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
Domain d4dqcb_: 4dqc B: [195898]
automated match to d2fxea_
complexed with 017, gol, po4
Details for d4dqcb_
PDB Entry: 4dqc (more details), 1.94 Å
PDB Description: crystal structure of (g16c/l38c) hiv-1 protease in complex with drv
PDB Compounds: (B:) Aspartyl proteaseSCOPe Domain Sequences for d4dqcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dqcb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiricgqlkealldtgaddtvieemncpgkwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
SCOPe Domain Coordinates for d4dqcb_:
Click to download the PDB-style file with coordinates for d4dqcb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dqcb_:
- d4dqcb_ first appeared in SCOPe 2.02
- d4dqcb_ appears in SCOPe 2.04
- d4dqcb_ appears in the current release, SCOPe 2.08
View in 3D
