Lineage for d4dnkb_ (4dnk B:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelixSuperfamily a.118.7: 14-3-3 protein [48445] (1 family) 
automatically mapped to Pfam PF00244Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) Protein automated matches [190238] (9 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187008] (42 PDB entries) 
Domain d4dnkb_: 4dnk B: [196005]
automated match to d2bq0b_
complexed with edo, po4
Details for d4dnkb_
PDB Entry: 4dnk (more details), 2.2 Å
PDB Description: crystal structure of a tyrosine 3-monooxygenase/tryptophan 5- monooxygenase activation protein, beta polypeptide (ywhab) from homo sapiens at 2.20 a resolution.
PDB Compounds: (B:) 14-3-3 protein beta/alphaSCOPe Domain Sequences for d4dnkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dnkb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfy
lkmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsen
SCOPe Domain Coordinates for d4dnkb_:
Click to download the PDB-style file with coordinates for d4dnkb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dnkb_:
- d4dnkb_ first appeared in SCOPe 2.02
- d4dnkb_ appears in SCOPe 2.05
- d4dnkb_ appears in SCOPe 2.07
- d4dnkb_ appears in the current release, SCOPe 2.08
View in 3D
