Lineage for d4dkna_ (4dkn A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.0: automated matches [191400] (1 protein)
not a true familyProtein automated matches [190526] (25 species)
not a true protein
Species Branchiostoma floridae [TaxId:7739] [226665] (5 PDB entries) 
Domain d4dkna_: 4dkn A: [219841]
automated match to d2c9ja_
Details for d4dkna_
PDB Entry: 4dkn (more details), 1.35 Å
PDB Description: crystal structure of amphioxus green fluorescent protein, gfpa1
PDB Compounds: (A:) amphioxus green fluorescent protein, gfpa1SCOPe Domain Sequences for d4dkna_:
Sequence, based on SEQRES records: (download)
>d4dkna_ d.22.1.0 (A:) automated matches {Branchiostoma floridae [TaxId: 7739]}
plpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiphlgygy
yqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmklmgsg
fpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyifdkpf
sadlmkkqpvfvyrkchvkatktevtlderekafyela
Sequence, based on observed residues (ATOM records): (download)
>d4dkna_ d.22.1.0 (A:) automated matches {Branchiostoma floridae [TaxId: 7739]}
plpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiphlgygy
yqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmklmgsg
fpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyifdkpf
kqpvfvyrkchvkatktevtlderekafyela
SCOPe Domain Coordinates for d4dkna_:
Click to download the PDB-style file with coordinates for d4dkna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dkna_:
- d4dkna_ first appeared in SCOPe 2.03
- d4dkna_ appears in SCOPe 2.06
- d4dkna_ appears in the current release, SCOPe 2.08
View in 3D
