Lineage for d4dj7d_ (4dj7 D:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1969995Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [256234] (3 PDB entries)
  8. 1970003Domain d4dj7d_: 4dj7 D: [240072]
    Other proteins in same PDB: d4dj7a_, d4dj7c_, d4dj7e_
    automated match to d4n5zb_
    complexed with nag

Details for d4dj7d_

PDB Entry: 4dj7 (more details), 2.81 Å

PDB Description: structure of the hemagglutinin complexed with 3sln from a highly pathogenic h7n7 influenza virus
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4dj7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj7d_ h.3.1.1 (D:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnri

SCOPe Domain Coordinates for d4dj7d_:

Click to download the PDB-style file with coordinates for d4dj7d_.
(The format of our PDB-style files is described here.)

Timeline for d4dj7d_: