Lineage for d4dh2d_ (4dh2 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347539Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2347540Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2347558Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2347559Protein automated matches [190928] (7 species)
    not a true protein
  7. 2347583Species Clostridium thermocellum [TaxId:203119] [194257] (4 PDB entries)
  8. 2347585Domain d4dh2d_: 4dh2 D: [262693]
    Other proteins in same PDB: d4dh2a1, d4dh2a2, d4dh2c1, d4dh2c2
    automated match to d4fl4g_
    complexed with ca, so4

Details for d4dh2d_

PDB Entry: 4dh2 (more details), 1.75 Å

PDB Description: Crystal structure of Coh-OlpC(Cthe_0452)-Doc435(Cthe_0435) complex: A novel type I Cohesin-Dockerin complex from Clostridium thermocellum ATTC 27405
PDB Compounds: (D:) Dockerin type 1

SCOPe Domain Sequences for d4dh2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dh2d_ a.139.1.0 (D:) automated matches {Clostridium thermocellum [TaxId: 203119]}
avigdvnadgvvnisdyvlmkryilriiadfpadddmwvgdvngdnvindidcnylkryl
lhmirefpkn

SCOPe Domain Coordinates for d4dh2d_:

Click to download the PDB-style file with coordinates for d4dh2d_.
(The format of our PDB-style files is described here.)

Timeline for d4dh2d_: