Lineage for d4df3b_ (4df3 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502171Species Aeropyrum pernix [TaxId:56636] [193600] (1 PDB entry)
  8. 2502173Domain d4df3b_: 4df3 B: [193601]
    automated match to d3id6c_
    complexed with sam

Details for d4df3b_

PDB Entry: 4df3 (more details), 1.73 Å

PDB Description: crystal structure of aeropyrum pernix fibrillarin in complex with natively bound s-adenosyl-l-methionine at 1.7a
PDB Compounds: (B:) Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase

SCOPe Domain Sequences for d4df3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4df3b_ c.66.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 56636]}
mvevvsvsrhdrwrgvyvveledgslriatknlvpgqrvygerifryngeeyrewnayrs
klaaallkglielpvkegdrilylgiasgttashmsdiigprgriygvefaprvmrdllt
vvrdrrnifpilgdarfpekyrhlvegvdglyadvaqpeqaaivvrnarfflrdggymlm
aikarsidvttepsevykreiktlmdggleikdvvhldpfdrdhamiyav

SCOPe Domain Coordinates for d4df3b_:

Click to download the PDB-style file with coordinates for d4df3b_.
(The format of our PDB-style files is described here.)

Timeline for d4df3b_: