Lineage for d4dbza_ (4dbz A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7Protein automated matches [190085] (51 species)
not a true protein
Species Streptomyces coelicolor [TaxId:1902] [189970] (5 PDB entries) 
Domain d4dbza_: 4dbz A: [194151]
automated match to d2rhcb_
complexed with ndp
Details for d4dbza_
PDB Entry: 4dbz (more details), 2.64 Å
PDB Description: Crystal Structure of V151L Actinorhodin Polyketide Ketoreductase with NADPH
PDB Compounds: (A:) ketoacyl reductaseSCOPe Domain Sequences for d4dbza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dbza_ c.2.1.2 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
dsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdv
rsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfrvtkq
vlkaggmlergtgrivniastggkqglvhaapysaskhgvvgftkalglelartgitvna
vcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpga
aavtaqalnvcgglgny
SCOPe Domain Coordinates for d4dbza_:
Click to download the PDB-style file with coordinates for d4dbza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dbza_:
- d4dbza_ first appeared in SCOPe 2.02
- d4dbza_ appears in SCOPe 2.05
- d4dbza_ appears in SCOPe 2.07
- d4dbza_ appears in the current release, SCOPe 2.08
View in 3D
