Lineage for d4d5ca2 (4d5c A:68-205)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. Family a.121.1.0: automated matches [227226] (1 protein)
    not a true family
  6. Protein automated matches [226967] (6 species)
    not a true protein
  7. Species Proteus mirabilis [TaxId:584] [311529] (1 PDB entry)
  8. Domain d4d5ca2: 4d5c A:68-205 [311530]
    Other proteins in same PDB: d4d5ca1
    automated match to d2vpra2
    complexed with so4

Details for d4d5ca2

PDB Entry: 4d5c (more details), 1.7000000000000002 Å

PDB Description: tetracycline repressor class j, apo form
PDB Compounds: (A:) tetracycline repressor protein tetr

SCOPe Domain Sequences for d4d5ca2:

Sequence, based on SEQRES records: (download)

>d4d5ca2 a.121.1.0 (A:68-205) automated matches {Proteus mirabilis [TaxId: 584]}
lplaneswqdflrnnaksfrqallmyrdggkihagtrpsanqfetseqqlqflcdagftl
tqavyalssiahftlgsvletqehqesqkerekvpkteinypplltqaidimdsdngeaa
flfvldvmisgletvlnn

Sequence, based on observed residues (ATOM records): (download)

>d4d5ca2 a.121.1.0 (A:68-205) automated matches {Proteus mirabilis [TaxId: 584]}
lplaneswqdflrnnaksfrqallmyrdggkihagtrpsanqfetseqqlqflcdagftl
tqavyalssiahftlgsvletqehqesqinypplltqaidimdsdngeaaflfvldvmis
gletvlnn

SCOPe Domain Coordinates for d4d5ca2 are not available.

Timeline for d4d5ca2:

Domains from same chain:
(mouse over for more information)
d4d5ca1