Lineage for d4d02a2 (4d02 A:250-400)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.0: automated matches [191330] (1 protein)
not a true familyProtein automated matches [190158] (30 species)
not a true protein
Species Escherichia coli [TaxId:83333] [259351] (5 PDB entries) 
Domain d4d02a2: 4d02 A:250-400 [259352]
Other proteins in same PDB: d4d02a1
automated match to d1ycga1
complexed with cl, fe, fmn, gol, o, po4
Details for d4d02a2
PDB Entry: 4d02 (more details), 1.76 Å
PDB Description: the crystallographic structure of flavorubredoxin from escherichia coli
PDB Compounds: (A:) anaerobic nitric oxide reductase flavorubredoxinSCOPe Domain Sequences for d4d02a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d02a2 c.23.5.0 (A:250-400) automated matches {Escherichia coli [TaxId: 83333]}
qedritifydtmsnntrmmadaiaqgiaetdprvavkifnvarsdkneiltnvfrskgvl
vgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlqdagfemsl
slkakwrpdqdalklcrehgreiarqwalap
SCOPe Domain Coordinates for d4d02a2:
Click to download the PDB-style file with coordinates for d4d02a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4d02a2:
- d4d02a2 first appeared in SCOPe 2.04
- d4d02a2 appears in SCOPe 2.06
- d4d02a2 appears in the current release, SCOPe 2.08
View in 3D
