Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (21 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (14 PDB entries) |
Domain d4czua_: 4czu A: [262679] automated match to d4czuc_ complexed with cps, so4; mutant |
PDB Entry: 4czu (more details), 1.9 Å
SCOPe Domain Sequences for d4czua_:
Sequence, based on SEQRES records: (download)
>d4czua_ d.144.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pgihsgrtrvgkyelgrtlgegtfakvkfarnvengdnvaikvidkekvlknkmiaqikr eistmklikhpnvirmfevmasktkiyfvlefvtggelfdkissngrlkedearkyfqql inavdychsrgvyhrdlkpenllldangalkvsdfglsalpqqvredgllhdtcgtpnyv apevinnkgydgakadlwscgvilfvlmagylpfedsnltslykkifkaeftcppwfsas akklikrildpnpatritfaevienewfkkgykapkfenadvslddvdaifddsgesknl vv
>d4czua_ d.144.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pgihsgrtrvgkyelgrtlgegtfakvkfarnvengdnvaikvidkekvlknkmiaqikr eistmklikhpnvirmfevmasktkiyfvlefvtggelfdkissngrlkedearkyfqql inavdychsrgvyhrdlkpenllldangalkvsdfglsalpqqvredgllhdtcgtpnyv apevinnkgydgakadlwscgvilfvlmagylpfedsnltslykkifkaeftcppwfsas akklikrildpnpatritfaevienewfkkgykapkfenddvdaifddsgesknlvv
Timeline for d4czua_: