| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) ![]() homotetramer |
| Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
| Protein automated matches [259190] (1 species) not a true protein |
| Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries) |
| Domain d4cz7b_: 4cz7 B: [259195] automated match to d3saka_ complexed with gol, po4 |
PDB Entry: 4cz7 (more details), 1.1 Å
SCOPe Domain Sequences for d4cz7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cz7b_ a.53.1.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
gseeiftlqvrgreryeilkklndslelsdvv
Timeline for d4cz7b_: