Lineage for d4cjxb1 (4cjx B:1-124)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890882Species Trypanosoma brucei [TaxId:999953] [311366] (1 PDB entry)
  8. 2890884Domain d4cjxb1: 4cjx B:1-124 [307117]
    Other proteins in same PDB: d4cjxa2, d4cjxb2
    automated match to d4a26b1
    complexed with 9l9, gol, nap, peg

Details for d4cjxb1

PDB Entry: 4cjx (more details), 2.05 Å

PDB Description: the crystal structure of trypanosoma brucei n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor
PDB Compounds: (B:) c-1-tetrahydrofolate synthase, cytoplasmic, putative

SCOPe Domain Sequences for d4cjxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cjxb1 c.58.1.0 (B:1-124) automated matches {Trypanosoma brucei [TaxId: 999953]}
mpeavvidgravakaiqkelteevallerrykgrrpglstiicgkrkdsqtyvrlkrkaa
aacgfrnfsvelpanvtqealerevirlneeeachsivvqlplpphidkvaalskikpek
dadc

SCOPe Domain Coordinates for d4cjxb1:

Click to download the PDB-style file with coordinates for d4cjxb1.
(The format of our PDB-style files is described here.)

Timeline for d4cjxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cjxb2