![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Trypanosoma brucei [TaxId:999953] [311366] (1 PDB entry) |
![]() | Domain d4cjxb1: 4cjx B:1-124 [307117] Other proteins in same PDB: d4cjxa2, d4cjxb2 automated match to d4a26b1 complexed with 9l9, gol, nap, peg |
PDB Entry: 4cjx (more details), 2.05 Å
SCOPe Domain Sequences for d4cjxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cjxb1 c.58.1.0 (B:1-124) automated matches {Trypanosoma brucei [TaxId: 999953]} mpeavvidgravakaiqkelteevallerrykgrrpglstiicgkrkdsqtyvrlkrkaa aacgfrnfsvelpanvtqealerevirlneeeachsivvqlplpphidkvaalskikpek dadc
Timeline for d4cjxb1: