Lineage for d4cdgc_ (4cdg C:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (18 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries) 
Domain d4cdgc_: 4cdg C: [235932]
automated match to d4cdgd_
complexed with adp, zn
Details for d4cdgc_
PDB Entry: 4cdg (more details), 2.79 Å
PDB Description: crystal structure of the bloom's syndrome helicase blm in complex with nanobody
PDB Compounds: (C:) NanobodySCOPe Domain Sequences for d4cdgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cdgc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgiwfsinnmawyrqtpgkqreriaiitsagttnyv
dsvkgrftisrddakntmylqmnslipedtavyycnlvadydmgfqsfwgrgtqvtvssh
hh
SCOPe Domain Coordinates for d4cdgc_:
Click to download the PDB-style file with coordinates for d4cdgc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4cdgc_:
- d4cdgc_ first appeared in SCOPe 2.03
- d4cdgc_ appears in SCOPe 2.04
- d4cdgc_ is called d4cdgc1 in SCOPe 2.06
- d4cdgc_ appears in the current release, SCOPe 2.08, called d4cdgc1
View in 3D
