Lineage for d4cbtb_ (4cbt B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. Protein automated matches [190786] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188039] (41 PDB entries)
  8. Domain d4cbtb_: 4cbt B: [251360]
    Other proteins in same PDB: d4cbta2, d4cbtc2, d4cbtc3
    automated match to d4cbyd_
    complexed with 9f4, zn

Details for d4cbtb_

PDB Entry: 4cbt (more details), 3.03 Å

PDB Description: design, synthesis, and biological evaluation of potent and selective class iia hdac inhibitors as a potential therapy for huntington's disease
PDB Compounds: (B:) Histone deacetylase 4

SCOPe Domain Sequences for d4cbtb_:

Sequence, based on SEQRES records: (download)

>d4cbtb_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprfttglvydtlmlkhqctcgsssshpehagriqsiwsrlqetglrgkcecirgrkatl
eelqtvhseahtllygtnplnrqkldskkllgslasvfvrlpcggvgvdsdtiwnevhsa
gaarlavgcvvelvfkvatgelkngfavvrppghhaeestpmgfcyfnsvavaakllqqr
lsvskilivdwdvhhgngtqqafysdpsvlymslhryddgnffpgsgapdevgtgpgvgf
nvnmaftggldppmgdaeylaafrtvvmpiasefapdvvlvssgfdaveghptplggynl
sarcfgyltkqlmglaggrivlalegghdltaicdaseacvsallgneldplpekvlqqr
pnanavrsmekvmeihskywrclq

Sequence, based on observed residues (ATOM records): (download)

>d4cbtb_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprfttglvydtlmlkhqctcgsssshpehagriqsiwsrlqetglrgkcecirgrkatl
eelqtvhseahtllygtnpsdtiwnevhsagaarlavgcvvelvfkvatgelkngfavvr
ppghhaeestpmgfcyfnsvavaakllqqrlsvskilivdwdvhhgngtqqafysdpsvl
ymslhryddgnffpgsgapdevgtgpgvgfnvnmaftggldppmgdaeylaafrtvvmpi
asefapdvvlvssgfdaveghptplggynlsarcfgyltkqlmglaggrivlalegghdl
taicdaseacvsallgndplpekvlqqrpnanavrsmekvmeihskywrclq

SCOPe Domain Coordinates for d4cbtb_ are not available.

Timeline for d4cbtb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4cbta1, d4cbta2, d4cbtc1, d4cbtc2, d4cbtc3